Protein Labeling Reagents
Apexbio Technology LLC D-Desthiobiotin 533-48-2 100mg
D-Desthiobiotin (CAS 533-48-2) is a derivative of biotin lacking the thiophene ring It binds to avidin and streptavidin with lower affinity compared to biotin enabling reversible interaction in affinity purification and protein chromatography protocols This property facilitates gentle elution of biotinylated proteins or other biomolecules without harsh conditions D-Desthiobiotin is widely employed for the labeling detection and isolation of proteins and cells in biochemical and cell-based assays providing an efficient tool for applications requiring temporary and specific capture of biomolecular targets
Sartorius Octet Amine Coupling Second Generation Reagent Kit
Amine Coupling Second Generation Reagent Kit is sufficient for 960 immobilizations onto Amine Reactive Second Generation (AR2G) Biosensors. For screening and kinetics biosensors only.
Lumiprobe Sulfo-Cyanine7 NHS ester, 1603861-95-5, 5mg
Molecular formula: C41H46N3KO10S2, Molecular weight: 844.05, Appearance: dark green powder, Solubility: good in water, DMF, DMSO; Sulfo-Cyanine7 is a water-soluble near infrared dye. The fluorophore is ideal for the labeling of complex proteins for subsequent live organism NIR imaging studies or sonoluminescence.
AnaSpec B AMYLOIED (1-40) HILYTE FLUR
Beta-Amyloid (1-40), HiLyte(TM) Fluor 488-labeled, Human[HiLyte(TM) Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4686.3; (0.1 mg) This is a fluorescent (HiLyte(TM) Fluor 488)-labeled B-Amyloid peptide, Abs/Em=503/528 nm.
LICOR IRDye 680RD NHS Ester (0.5 mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
Meso Scale Discovery V-PLEX Plus Mouse IL-17A/F Kit
The Meso Scale Discovery V-PLEX Mouse IL-17A/F Kit is a multiplex immunoassay for measuring mouse interleukin 17A (IL-17A) and interleukin 17F (IL-17F) in various biological fluids It uses MSD s SULFO-TAG labels and multi-array technology for sensitive detection with a broad dynamic range The assay requires only 50 L of sample and has a 2 5-hour protocol The kit includes a 96-well plate with capture antibodies detection antibodies with SULFO-TAG calibrator blend and assay diluent enabling efficient quantification of IL-17A and IL-17F
New England Biolabs, Inc. SNAP-Cell Oregon Green – 50 nmol
SNAP-Cell Oregon Green is a photostable green fluorescent substrate that can be used to label SNAP-tag fusion proteins inside living cells or in vitro. Conjugates of Oregon Green are more photostable than those of fluorescein, and their fluorescence properties are essentially pH insensitive in the physiological pH range.